PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G030400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 375aa    MW: 41175.5 Da    PI: 8.1103
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G030400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1553.3e-48131393128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+++yL + + gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+++ 
  Brast02G030400.1.p  13 PGFRFHPTEEELLDFYLSRVALGKKLHF-DIIGTLNIYRHDPWDLPVMAKIGEREWYFFVPRDRKAGSGGRPNRTTERGFWKATGSDRPIR 102
                         9*************************99.99***************988999*************************************** PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s+   ++l+glkktLvfy+grap+g+ktdWvm+eyrl
  Brast02G030400.1.p 103 SAgdPKRLIGLKKTLVFYQGRAPRGTKTDWVMNEYRL 139
                         *9666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-577163IPR003441NAC domain
PROSITE profilePS5100555.19211163IPR003441NAC domain
PfamPF023654.0E-2413139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASNNMEVEQ ELPGFRFHPT EEELLDFYLS RVALGKKLHF DIIGTLNIYR HDPWDLPVMA  60
KIGEREWYFF VPRDRKAGSG GRPNRTTERG FWKATGSDRP IRSAGDPKRL IGLKKTLVFY  120
QGRAPRGTKT DWVMNEYRLP DAQGSGSAAP PKEDMVLCKI YRKATPLKEL EQRASAMEEL  180
QQQQQRCGYG GKNGAFMGRA AGDGDDYLSP SSSFEFDDVV QDNFLIPSSS SSSSAAGNNS  240
RKINHAPKDA KREAEVAAVT VAISKPSSSL PQPAGHGASK PPVLQLPVAS HGASKPPVLQ  300
LPVAGHGVFD FDLPTLQQLP AVASHGMPDL PSLQLPAAGH GAFDWLQQDP FLAQLRSPWQ  360
DQHCLSPYAH LLYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4931636168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070901e-166AK107090.1 Oryza sativa Japonica Group cDNA clone:002-121-G12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558884.10.0PREDICTED: NAC domain-containing protein 67-like
TrEMBLA0A0Q3P1B10.0A0A0Q3P1B1_BRADI; Uncharacterized protein
STRINGBRADI1G76207.11e-175(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.19e-86NAC domain containing protein 36